We hear about the same 2 or 3 science backed supplements over and over... are there any others with solid evidence?
This was a totally unscripted exchange between Ben and I (I didn't even prompt him on the questions!) Check out his awesome channel: [ Ссылка ]
Watch my most popular science videos: [ Ссылка ]
-------------------------------
The "Basic" 3:
▹ Creatine:
Learn more: [ Ссылка ]
My recommended creatine supplement:
Powder: [ Ссылка ]
Pills: [ Ссылка ]
‣ Save $$ using discount JEFF
▹ Whey Protein:
Learn more: [ Ссылка ]
My recommended protein supplement:
Powder: [ Ссылка ]
Bars: [ Ссылка ]
‣ Save $$ using discount JEFF
▹ Caffeine:
Learn more: [ Ссылка ]
My recommended pre-workout:
[ Ссылка ]
‣ Save $$ using discount JEFF
-------------------------------
The 3 "Extras"
▹ Turmeric Extract (Curcumin)
Learn more: [ Ссылка ]
▹ Fish Oil
Learn More: [ Ссылка ]
My recommended fish oil supplement: [ Ссылка ]
‣ Save $$ using discount JEFF
▹ Ashwagandha
Learn more: [ Ссылка ]
My recommended Ashwagandha product (Multivitamin/multimineral):
Men's: [ Ссылка ]
Women's: [ Ссылка ]
‣ Save $$ using discount JEFF
-------------------------------
Help SUPPORT the channel by:
1. Trying one of my training programs: → [ Ссылка ]
2. Buying my channel merch:
→ [ Ссылка ]
3. Checking out what my sponsors have to offer:
▹ MASS (Monthly Research Review)
‣ [ Ссылка ]
‣ Only $25/month (pre-paid yearly)
▹ PEScience Supplements
‣ [ Ссылка ]
‣ Use discount code JEFF to save $$
▹ RISE Training Gear and Sportwear
‣ [ Ссылка ]
‣ Use discount code JEFF to save 10%
▹ Body-Analyser Weight and Bodyfat % Scale
‣ [ Ссылка ]
‣ Use the above link to save 60% off!
-------------------------------
Follow me on social media:
INSTAGRAM ‣ [ Ссылка ]
SNAPCHAT ‣ [ Ссылка ]
FACEBOOK ‣ [ Ссылка ]
TWITTER ‣ [ Ссылка ]
PODCAST ‣ The Jeff Nippard Podcast on iTunes and Stitcher
-------------------------------
SOURCES:
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
-------------------------------
Edited by me using Final Cut Pro X
-------------------------------
About me: I'm a Canadian natural pro bodybuilder and internationally-qualified powerlifter with a BSc in biochemistry/chemistry and a passion for science. I've been training for 12 years drug-free. I'm 5'5 and fluctuate between 160 lbs (lean) and 180 lbs (bulked).
-------------------------------
Disclaimers: Jeff Nippard is not a doctor or a medical professional. Always consult a physician before starting any exercise program. Use of this information is strictly at your own risk. Jeff Nippard will not assume any liability for direct or indirect losses or damages that may result from the use of information contained in this video including but not limited to economic loss, injury, illness or death.
PEScience is my supplement sponsor and I earn a commission from products that are bought using links in the description box.
3 Supplements You Aren't Taking BUT Should Consider!
Теги
vlogiifymsciencebodybuildinglegsarmschestbackfit couplebuild musclejeff nippardsummer shreddingleanrippedabsdietlose weightfatfitnessflexbicepsshreddedgymsharkalphaletephysiquemotivationnatural bodybuildingcanadianworkout supplementprotein powderfish oiljeff cavalieresix pack absfat lossweight lossomega 3what supplements to take to gain musclepicture fitbest workout supplementswhat supplements to take