1-8 Titan Lifestyle with Big Dru & John w/LIVE Q&A!
This show’s TOPICS:
Therapy of the Week: New Year's Therapy Special
Thanks to all who came to Titan booth at the Olympia
Elon musk selling possessions to go live on Mars
Tampa Super Bowl in 1 month: Many unknowns
Jordan wins trademark battle w/China:$46k
CDC: Offers new incredible immunity news
EVENTS:
2/21: Festivals of Speed St. Pete
3/14: Festivals of Speed Orlando
1/4/20 Weekly Newsletter: New Year's Therapy Package Special!
([ Ссылка ])
Text:titanmedical to:22828 to get on our emailing list
Titan podcasts: [ Ссылка ]
#titan #bigdru #druborden #titanmedical #johntsikouris #health #medicalcenter #peptide
We offer Hormone Replacement Therapy, Medical Weight Loss, Injectable Vitamin & Amino Therapies, Relationship, Bedroom Enhancing Therapies, On-Site or Nationwide Blood Work Testing, Peptide Therapies, In-House IV Therapy, & Primary Care. We are based in Tampa, Florida but YES we service NATIONWIDE!
We can help you enhance your life and performance while operating at optimal health levels. We have medical doctors and start with blood work testing to get you on the right track! Some of our therapies are available without blood work testing.
Call Titan Medical Center to learn how you can have a healthier, stronger life. We offer telemedicine (via FaceTime or Skype) from the comfort of your own home where you will see a certified medical provider.
Our Titan therapies are doctor prescribed & shipped directly to your doorstep! We service nationwide!
727-389-3220 or [ Ссылка ]
Follow us on
FACEBOOK: [ Ссылка ]
INSTAGRAM: [ Ссылка ]
TWITTER: [ Ссылка ]
1/8/21 Titan Lifestyle with Big Dru and John!
Теги
Hormone replacement therapyHRTtestosteroneinjectable vitamins and amino acidsweight losstitanmedicaltitanmedicaltherapiesHormonesbloodworkvitaminsaminoacidsamino acidspeptideslifestylehormoneoptimizationhealthlabtestslabresultsmalehormonesfemalehormoneslowtmenopauseandropausefatigueadrenalsthyroidestrogenfeelgoodagaincortisolrestfulsleephealthandwellnessagemanagementoptimalwellnessfitnessclinicgymexercisemusclemodelstsikourisbig dru