Tasting some mopane worms from Zimbabwe i've been sent in
Subscribe for regular videos [ Ссылка ]
Buy my book [ Ссылка ]
More food fear videos i've done on the playlist
[ Ссылка ]
More info
Mopane worms get their English name from hanging out on Mopane trees which are prevalent in Southern Africa. And they are not worms, but caterpillars, the larvae of the Emperor Moth.Mopane (sometimes spelled Mopani) worms are called phane in Botswana, mashonja in Zimbabwe and parts of South Africa, and omangungu in Namibia. Nutritionally they pack a punch consisting of 60% protein along with good amounts of iron and calcium. Since they require little input in the way of resources, it has become a valuable and profitable source of food and income.
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
[ Ссылка ]
My Virgin Kitchen is a YouTube channel I created when I wanted to teach myself how to cook and create a video diary of the journey [ Ссылка ]. I have never had a professional lesson & am just your every day chap attempting recipes to inspire you guys to try too. Most uploads are how to recipe cooking videos, but some fun is had too on Sunday Funday when anything goes, including giant foods, mini foods, taste testing foods sent from around the World, food gadgets and many more. Any requests for recipes / cool stuff you've seen let me know! I try my best to reply to as many comments as possible, but please interact with eachother and be respectful :-) #barrylewis
MOPANE WORM (CATERPILLAR) TASTE TEST
Теги
Mopane Worm taste testwormcaterpillareating wormsbushtucker trialZimbabwe (Country)zimbabweanfoodsnacksbugseatingtastetastingtaste testGonimbrasia Belina (Organism Classification)challengedelicacyemperor mothfood fearbarry lewismy virgin kitchenmyvirginkitchenrecipevideocookingukenglandnovicetutorialtesthow todemonstrationexplanationwhat are mopane wormseating caterpillarsMopane (Organism Classification)Bug